Product Info Summary
| SKU: | PROTO54907 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF
View all TNFSF12 recombinant proteins
SKU/Catalog Number
PROTO54907
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
TNF-related Weak Inducer of Apoptosis (TWEAK) is a type II membrane protein of the tumor necrosis factor (TNF) family members, high levels expression in mouse peritoneal macrophages. The murine and human TWEAK homologs are very close related (~93% sequence identity in the receptor-binding domain). TWEAK is a 17.3 kDa protein containing 129 residues. TWEAK induce apoptosis through cognate receptor Fn14 activate caspase-8 and caspase-3, in HSC3 cells KATO-III gastric adenocarcinoma cells and IFN-γ-treated HT-29. TWEAK stimulate inflammatory cytokines in HT-29, A375 cells, WI-38 fibroblast sand astrocytes.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO54907)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
27.4 kDa
Molecular weight
The protein has a calculated MW of 18.14 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in HUVEC cells. The ED₅₀ for this effect is <0.2 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MSAPKGRKARPRRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse TWEAK
Specific Publications For Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF (PROTO54907)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant TWEAK (TNF-related weak inducer of apoptosis) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
