MPND (NM_032868) Human Recombinant Protein

Mpnd protein,

Recombinant protein of human MPN domain containing (MPND)

Product Info Summary

SKU: PROTQ8N594
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MPND (NM_032868) Human Recombinant Protein

View all Mpnd recombinant proteins

SKU/Catalog Number

PROTQ8N594

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MPN domain containing (MPND)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MPND (NM_032868) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N594)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

50.5 kDa

Amino Acid Sequence

MAAPEPLSPAGGAGEEAPEEDEDEAEAEDPERPNAGAGGGRSGGGGSSVSGGGGGGGAGAGGCGGPGGALTRRAVTLRVLLKDALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPASEGEEEELLMEEEEEDVLAGVSAEDKSRRPLGKSPSEPAHPEATTPGKRVDSKIRVPVRYCMLGSRDLARNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLLDFHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKISPFWVMPPPEMLLVEFYKGSPDLVRLQEPWSQEHTYLDKLKISLASRTPKDQSLCHVLEQVCGVLKQGS

Validation Images & Assay Conditions

Gene/Protein Information For MPND (Source: Uniprot.org, NCBI)

Gene Name

MPND

Full Name

MPN domain-containing protein

Weight

50.5 kDa

Superfamily

peptidase M67 family

Alternative Names

EC 3.4; FLJ14981; MPN domain containing; MPN domain-containing protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MPND, check out the MPND Infographic

MPND infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MPND: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N594

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MPND (NM_032868) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MPND (NM_032868) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MPND (NM_032868) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N594
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.