MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein

MRCL3 protein,

Product Info Summary

SKU: PROTP19105
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein

View all MRCL3 recombinant proteins

SKU/Catalog Number

PROTP19105

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human myosin, light chain 12A, regulatory, non-sarcomeric (MYL12A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19105)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.6 kDa

Amino Acid Sequence

MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Validation Images & Assay Conditions

Gene/Protein Information For MYL12A (Source: Uniprot.org, NCBI)

Gene Name

MYL12A

Full Name

Myosin regulatory light chain 12A

Weight

19.6 kDa

Alternative Names

MLCBMyosin RLC; MRCL3; MRLC3MLC-2B; MYL2B; myosin regulatory light chain 12A; Myosin regulatory light chain 2, nonsarcomeric; myosin regulatory light chain 3; myosin regulatory light chain MRCL3; Myosin regulatory light chain MRLC3; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD); RLC MYL12A HEL-S-24, MLC-2B, MLCB, MRCL3, MRLC3, MYL2B myosin light chain 12A myosin regulatory light chain 12A|epididymis secretory protein Li 24|myosin RLC|myosin regulatory light chain 2, nonsarcomeric|myosin regulatory light chain 3|myosin regulatory light chain MRLC3|myosin, light chain 12A, regulatory, non-sarcomeric|myosin, light polypeptide, regulatory, non-sarcomeric (20kD)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MYL12A, check out the MYL12A Infographic

MYL12A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MYL12A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP19105

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRCL3 (MYL12A) (NM_006471) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP19105
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.