Olfactory Marker Protein (OMP) (NM_006189) Human Recombinant Protein

Olfactory Marker Protein protein,

Product Info Summary

SKU: PROTP47874
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Olfactory Marker Protein (OMP) (NM_006189) Human Recombinant Protein

View all Olfactory Marker Protein recombinant proteins

SKU/Catalog Number

PROTP47874

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human olfactory marker protein (OMP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Olfactory Marker Protein (OMP) (NM_006189) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP47874)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.8 kDa

Amino Acid Sequence

MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL

Validation Images & Assay Conditions

Gene/Protein Information For OMP (Source: Uniprot.org, NCBI)

Gene Name

OMP

Full Name

Olfactory marker protein

Weight

18.8 kDa

Superfamily

olfactory marker protein family

Alternative Names

olfactory marker protein; Olfactory neuronal-specific protein OMP olfactory marker protein olfactory marker protein|olfactory neuronal-specific protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on OMP, check out the OMP Infographic

OMP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OMP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP47874

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Olfactory Marker Protein (OMP) (NM_006189) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Olfactory Marker Protein (OMP) (NM_006189) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Olfactory Marker Protein (OMP) (NM_006189) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP47874
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.