PAFAH1B3 (NM_002573) Human Recombinant Protein

PAFAH1B3 protein,

Product Info Summary

SKU: PROTQ15102
Size: 20 µg
Source: HEK293T

Product Name

PAFAH1B3 (NM_002573) Human Recombinant Protein

View all PAFAH1B3 recombinant proteins

SKU/Catalog Number

PROTQ15102

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAFAH1B3 (NM_002573) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15102)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.6 kDa

Amino Acid Sequence

MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP

Validation Images & Assay Conditions

Gene/Protein Information For PAFAH1B3 (Source: Uniprot.org, NCBI)

Gene Name

PAFAH1B3

Full Name

Platelet-activating factor acetylhydrolase IB subunit gamma

Weight

25.6 kDa

Superfamily

GDSL' lipolytic enzyme family

Alternative Names

EC 3.1.1.47; FLJ44990; PAF acetylhydrolase 29 kDa subunit; PAF-AH 29 kDa subunit; PAFAH subunit gamma; PAF-AH subunit gamma; PAF-AH1b alpha 1 subunit; PAFAHG; platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa); platelet-activating factor acetylhydrolase IB subunit gamma; platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD); platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa; platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) PAFAH1B3 PAFAHG platelet activating factor acetylhydrolase 1b catalytic subunit 3 platelet-activating factor acetylhydrolase IB subunit alpha1|PAF acetylhydrolase 29 kDa subunit|PAF-AH 29 kDa subunit|PAF-AH subunit gamma|PAF-AH1b alpha 1 subunit|PAFAH subunit gamma|epididymis secretory sperm binding protein|platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa)|platelet-activating factor acetylhydrolase IB subunit gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAFAH1B3, check out the PAFAH1B3 Infographic

PAFAH1B3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAFAH1B3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15102

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PAFAH1B3 (NM_002573) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAFAH1B3 (NM_002573) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAFAH1B3 (NM_002573) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15102
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.