PAGE5 (NM_130467) Human Recombinant Protein

PAGE5 protein,

Purified recombinant protein of Homo sapiens P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1

Product Info Summary

SKU: PROTQ96GU1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PAGE5 (NM_130467) Human Recombinant Protein

View all PAGE5 recombinant proteins

SKU/Catalog Number

PROTQ96GU1

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens P antigen family, member 5 (prostate associated) (PAGE5), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAGE5 (NM_130467) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96GU1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.9 kDa

Amino Acid Sequence

MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAPSGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL

Validation Images & Assay Conditions

Gene/Protein Information For PAGE5 (Source: Uniprot.org, NCBI)

Gene Name

PAGE5

Full Name

P antigen family member 5

Weight

13.9 kDa

Superfamily

GAGE family

Alternative Names

P antigen family member 5 PAGE5 CT16, CT16.1, CT16.2, GAGEE1, PAGE-5 PAGE family member 5 P antigen family member 5|P antigen family, member 5 (prostate associated)|cancer/testis antigen 16.1|cancer/testis antigen family 16, member 1|cancer/testis antigen family 16, member 2|g antigen family E member 1|prostate-associated gene 5 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAGE5, check out the PAGE5 Infographic

PAGE5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAGE5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96GU1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PAGE5 (NM_130467) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAGE5 (NM_130467) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAGE5 (NM_130467) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96GU1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.