Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein

Pallidin protein,

Product Info Summary

SKU: PROTQ9UL45
Size: 20 µg
Source: HEK293T

Product Name

Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein

View all Pallidin recombinant proteins

SKU/Catalog Number

PROTQ9UL45

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pallidin homolog (mouse) (PLDN)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UL45)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.6 kDa

Amino Acid Sequence

MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM

Validation Images & Assay Conditions

Gene/Protein Information For Bloc1s6 (Source: Uniprot.org, NCBI)

Gene Name

Bloc1s6

Full Name

Biogenesis of lysosome-related organelles complex 1 subunit 6

Weight

19.6 kDa

Superfamily

BLOC1S6 family

Alternative Names

pallid (mouse) homolog, pallidin; Pallid protein homolog; PALLID; pallidin homolog (mouse); pallidin; PAsyntaxin 13 binding protein 1; syntaxin 13-interacting protein pallid; Syntaxin 13-interacting protein Bloc1s6|BLOC, BLOC-1, Hps9, P, Pldn, Stx13bp1, pa|biogenesis of lysosomal organelles complex-1, subunit 6, pallidin|biogenesis of lysosome-related organelles complex 1 subunit 6|BLOC-1 subunit 6|biogenesis of organelles complex-1, subunit 6, pallidin|pallid protein|pallidin|syntaxin 13 binding protein 1|syntaxin 13-interacting protein pallid

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Bloc1s6, check out the Bloc1s6 Infographic

Bloc1s6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Bloc1s6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UL45

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UL45
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.