PMVK (NM_006556) Human Recombinant Protein

PMVK/phosphomevalonate kinase protein,

Product Info Summary

SKU: PROTQ15126
Size: 20 µg
Source: HEK293T

Product Name

PMVK (NM_006556) Human Recombinant Protein

View all PMVK/phosphomevalonate kinase recombinant proteins

SKU/Catalog Number

PROTQ15126

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphomevalonate kinase (PMVK)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PMVK (NM_006556) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15126)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.8 kDa

Amino Acid Sequence

MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

Validation Images & Assay Conditions

Gene/Protein Information For PMVK (Source: Uniprot.org, NCBI)

Gene Name

PMVK

Full Name

Phosphomevalonate kinase

Weight

21.8 kDa

Alternative Names

hPMK; HUMPMKI; phosphomevalonate kinase; PMKA; PMKASE; PMKEC 2.7.4.2; PMKI PMVK HUMPMKI, PMK, PMKA, PMKASE, POROK1 phosphomevalonate kinase phosphomevalonate kinase|testis tissue sperm-binding protein Li 95mP

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PMVK, check out the PMVK Infographic

PMVK infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PMVK: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15126

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PMVK (NM_006556) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PMVK (NM_006556) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PMVK (NM_006556) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15126
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.