POLR2H (NM_006232) Human Recombinant Protein

RPB8 protein,

Product Info Summary

SKU: PROTP52434
Size: 20 µg
Source: HEK293T

Product Name

POLR2H (NM_006232) Human Recombinant Protein

View all RPB8 recombinant proteins

SKU/Catalog Number

PROTP52434

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLR2H (NM_006232) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP52434)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17 kDa

Amino Acid Sequence

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Validation Images & Assay Conditions

Gene/Protein Information For POLR2H (Source: Uniprot.org, NCBI)

Gene Name

POLR2H

Full Name

DNA-directed RNA polymerases I, II, and III subunit RPABC3

Weight

17 kDa

Superfamily

eukaryotic RPB8 RNA polymerase subunit family

Alternative Names

DNA-directed RNA polymerases I, II, and III subunit RPABC3; hsRPB8; II, and III 17.1 kDa polypeptide; II, and III subunit ABC3; polymerase (RNA) II (DNA directed) polypeptide H; RPB8 homolog POLR2H RPABC3, RPB17, RPB8 RNA polymerase II, I and III subunit H DNA-directed RNA polymerases I, II, and III subunit RPABC3|DNA-directed RNA polymerase II subunit H|DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide|RNA polymerase II subunit H|RPB8 homolog|polymerase (RNA) II (DNA directed) polypeptide H|polymerase (RNA) II subunit H

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR2H, check out the POLR2H Infographic

POLR2H infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR2H: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP52434

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR2H (NM_006232) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR2H (NM_006232) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR2H (NM_006232) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP52434
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.