POLR2J2 (POLR2J3) (NM_001097615) Human Recombinant Protein

POLR2J3 protein,

Product Info Summary

SKU: PROTQ9H1A7
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

POLR2J2 (POLR2J3) (NM_001097615) Human Recombinant Protein

View all POLR2J3 recombinant proteins

SKU/Catalog Number

PROTQ9H1A7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J3 (POLR2J3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

POLR2J2 (POLR2J3) (NM_001097615) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H1A7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.092kDa

Amino Acid Sequence

MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP

Validation Images & Assay Conditions

Gene/Protein Information For POLR2J3 (Source: Uniprot.org, NCBI)

Gene Name

POLR2J3

Full Name

DNA-directed RNA polymerase II subunit RPB11-b2

Weight

13.092kDa

Superfamily

archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family

Alternative Names

DNA-directed RNA polymerase II subunit RPB11-b2 POLR2J3 POLR2J2, RPB11b1, RPB11b2 RNA polymerase II subunit J3 DNA-directed RNA polymerase II subunit RPB11-b2|DNA-directed RNA polymerase II subunit 11|DNA-directed RNA polymerase II subunit J2|DNA-directed RNA polymerase II subunit J3|DNA-directed RNA polymerase II subunit RPB11-b1|RNA polymerase II subunit B11-b1|RNA polymerase II subunit B11-b2|polymerase (RNA) II (DNA directed) polypeptide J3|polymerase (RNA) II subunit J3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLR2J3, check out the POLR2J3 Infographic

POLR2J3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLR2J3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H1A7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR2J2 (POLR2J3) (NM_001097615) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR2J2 (POLR2J3) (NM_001097615) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR2J2 (POLR2J3) (NM_001097615) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H1A7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.