PRPS2 (NM_001039091) Human Recombinant Protein

PRPS2 protein,

Product Info Summary

SKU: PROTP11908
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PRPS2 (NM_001039091) Human Recombinant Protein

View all PRPS2 recombinant proteins

SKU/Catalog Number

PROTP11908

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosphoribosyl pyrophosphate synthetase 2 (PRPS2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRPS2 (NM_001039091) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP11908)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.9 kDa

Amino Acid Sequence

MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKVGESRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Validation Images & Assay Conditions

Gene/Protein Information For PRPS2 (Source: Uniprot.org, NCBI)

Gene Name

PRPS2

Full Name

Ribose-phosphate pyrophosphokinase 2

Weight

34.9 kDa

Superfamily

ribose-phosphate pyrophosphokinase family

Alternative Names

EC 2.7.6.1; Phosphoribosyl pyrophosphate synthase II; phosphoribosyl pyrophosphate synthetase 2; PPRibP synthetase; PPRibP; PRSII; PRS-II; ribose-phosphate diphosphokinase 2; ribose-phosphate pyrophosphokinase 2 PRPS2 PRSII phosphoribosyl pyrophosphate synthetase 2 ribose-phosphate pyrophosphokinase 2|PPRibP synthetase|PRS-II|phosphoribosyl pyrophosphate synthase II|ribose-phosphate diphosphokinase 2|testicular secretory protein Li 41

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRPS2, check out the PRPS2 Infographic

PRPS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRPS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP11908

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRPS2 (NM_001039091) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRPS2 (NM_001039091) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRPS2 (NM_001039091) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP11908
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.