PUSL1 (NM_153339) Human Recombinant Protein

PUSL1 protein,

Recombinant protein of human pseudouridylate synthase-like 1 (PUSL1)

Product Info Summary

SKU: PROTQ8N0Z8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PUSL1 (NM_153339) Human Recombinant Protein

View all PUSL1 recombinant proteins

SKU/Catalog Number

PROTQ8N0Z8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pseudouridylate synthase-like 1 (PUSL1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

PUSL1 (NM_153339) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N0Z8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.233kDa

Amino Acid Sequence

MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERNLCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFGSHG

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For PUSL1 (Source: Uniprot.org, NCBI)

Gene Name

PUSL1

Full Name

tRNA pseudouridine synthase-like 1

Weight

33.233kDa

Superfamily

tRNA pseudouridine synthase TruA family

Alternative Names

EC 5.4.99.-; FLJ90811; pseudouridylate synthase-like 1; tRNA pseudouridine synthase-like 1; tRNA pseudouridylate synthase-like 1; tRNA-uridine isomerase-like 1 PUSL1 pseudouridine synthase like 1 tRNA pseudouridine synthase-like 1|pseudouridylate synthase like 1|tRNA pseudouridylate synthase-like 1|tRNA-uridine isomerase-like 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PUSL1, check out the PUSL1 Infographic

PUSL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PUSL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N0Z8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PUSL1 (NM_153339) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review PUSL1 (NM_153339) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PUSL1 (NM_153339) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
Eddy test
In stock
Order Product
PROTQ8N0Z8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.