RAG1AP1 (SLC50A1) (NM_018845) Human Recombinant Protein

RAG1AP1 protein,

Recombinant protein of human recombination activating gene 1 activating protein 1 (RAG1AP1), transcript variant 1

Product Info Summary

SKU: PROTQ9BRV3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RAG1AP1 (SLC50A1) (NM_018845) Human Recombinant Protein

View all RAG1AP1 recombinant proteins

SKU/Catalog Number

PROTQ9BRV3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human recombination activating gene 1 activating protein 1 (RAG1AP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAG1AP1 (SLC50A1) (NM_018845) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BRV3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.8 kDa

Amino Acid Sequence

MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Validation Images & Assay Conditions

Gene/Protein Information For Slc50a1 (Source: Uniprot.org, NCBI)

Gene Name

Slc50a1

Full Name

Sugar transporter SWEET1

Weight

24.8 kDa

Superfamily

SWEET sugar transporter family

Alternative Names

HsSWEET1RAG1-activating protein 1; probable sugar transporter RAG1AP1; RAG1AP1SWEET1; recombination activating gene 1 activating protein 1; RZPDo834D038D; SCPRP11-540D14.5; slv; solute carrier family 50 (sugar transporter), member 1; Solute carrier family 50 member 1; Stromal cell protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Slc50a1, check out the Slc50a1 Infographic

Slc50a1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Slc50a1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BRV3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAG1AP1 (SLC50A1) (NM_018845) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAG1AP1 (SLC50A1) (NM_018845) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAG1AP1 (SLC50A1) (NM_018845) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BRV3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.