RGP1 (NM_001080496) Human Recombinant Protein

RGP1 protein,

Recombinant protein of human RGP1 retrograde golgi transport homolog (S. cerevisiae) (RGP1)

Product Info Summary

SKU: PROTQ92546
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RGP1 (NM_001080496) Human Recombinant Protein

View all RGP1 recombinant proteins

SKU/Catalog Number

PROTQ92546

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RGP1 retrograde golgi transport homolog (S. cerevisiae) (RGP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

RGP1 (NM_001080496) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92546)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.455kDa

Amino Acid Sequence

MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI

Validation Images & Assay Conditions

Gene/Protein Information For RGP1 (Source: Uniprot.org, NCBI)

Gene Name

RGP1

Full Name

RAB6A-GEF complex partner protein 2

Weight

42.455kDa

Superfamily

RGP1 family

Alternative Names

retrograde Golgi transport protein RGP1 homolog; RGP1 retrograde golgi transport homolog (S. cerevisiae) RGP1 KIAA0258 RGP1 homolog, RAB6A GEF complex partner 1 RAB6A-GEF complex partner protein 2|RGP1 retrograde golgi transport homolog|retrograde Golgi transport protein RGP1 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RGP1, check out the RGP1 Infographic

RGP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RGP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92546

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RGP1 (NM_001080496) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RGP1 (NM_001080496) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RGP1 (NM_001080496) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92546
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.