SLC39A5 (NM_173596) Human Recombinant Protein

Slc39a5 protein,

Recombinant protein of human solute carrier family 39 (metal ion transporter), member 5 (SLC39A5), transcript variant 1

Product Info Summary

SKU: PROTQ6ZMH5
Size: 20 µg
Source: HEK293T

Product Name

SLC39A5 (NM_173596) Human Recombinant Protein

View all Slc39a5 recombinant proteins

SKU/Catalog Number

PROTQ6ZMH5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human solute carrier family 39 (metal ion transporter), member 5 (SLC39A5), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SLC39A5 (NM_173596) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6ZMH5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

56.1 kDa

Amino Acid Sequence

MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG

Validation Images & Assay Conditions

Gene/Protein Information For Slc39a5 (Source: Uniprot.org, NCBI)

Gene Name

Slc39a5

Full Name

Zinc transporter ZIP5

Weight

56.1 kDa

Superfamily

ZIP transporter (TC 2.A.5) family

Alternative Names

LZT-Hs7; MGC34778; solute carrier family 39 (metal ion transporter), member 5; Solute carrier family 39 member 5; zinc transporter ZIP5; ZIP5; ZIP-5; Zrt- and Irt-like protein 5 Slc39a5|1810013D05Rik, 2010205A06Rik, Zi, Zip5|solute carrier family 39 (metal ion transporter), member 5|zinc transporter ZIP5|ZIP-5|solute carrier family 39 member 5|zrt- and Irt-like protein 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Slc39a5, check out the Slc39a5 Infographic

Slc39a5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Slc39a5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6ZMH5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SLC39A5 (NM_173596) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SLC39A5 (NM_173596) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SLC39A5 (NM_173596) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6ZMH5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.