Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein

SMIM6 protein,

Recombinant protein of human hypothetical protein LOC100130933 (LOC100130933).

Product Info Summary

SKU: PROTP0DI80
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein

View all SMIM6 recombinant proteins

SKU/Catalog Number

PROTP0DI80

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hypothetical protein LOC100130933 (LOC100130933).

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0DI80)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

6.8 kDa

Amino Acid Sequence

MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGEEE

Validation Images & Assay Conditions

Gene/Protein Information For SMIM6 (Source: Uniprot.org, NCBI)

Gene Name

SMIM6

Full Name

Small integral membrane protein 6

Weight

6.8 kDa

Alternative Names

C17orf110; Chromosome 17 Open Reading Frame 110; Small Integral Membrane Protein 6 SMIM6 C17orf110, ELN small integral membrane protein 6 small integral membrane protein 6|endoregulin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SMIM6, check out the SMIM6 Infographic

SMIM6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SMIM6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0DI80

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0DI80
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.