SPAG16 (NM_001025436) Human Recombinant Protein

Spag16 protein,

Recombinant protein of human sperm associated antigen 16 (SPAG16), transcript variant 2

Product Info Summary

SKU: PROTQ8N0X2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPAG16 (NM_001025436) Human Recombinant Protein

View all Spag16 recombinant proteins

SKU/Catalog Number

PROTQ8N0X2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sperm associated antigen 16 (SPAG16), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPAG16 (NM_001025436) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N0X2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

71.473kDa

Amino Acid Sequence

MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

Validation Images & Assay Conditions

Gene/Protein Information For Spag16 (Source: Uniprot.org, NCBI)

Gene Name

Spag16

Full Name

Sperm-associated antigen 16 protein

Weight

71.473kDa

Alternative Names

DKFZp666P1710; FLJ22724; FLJ37717; Pf20 protein homolog; PF20MGC87036; sperm associated antigen 16; sperm-associated antigen 16 protein; sperm-associated WD repeat protein; WD repeat domain 29; WDR29 Spag16|4921511D23Rik, 4930524F24Rik, 4930585K05Rik, AV261009, Pf2, Pf20, Wdr2, Wdr29|sperm associated antigen 16|sperm-associated antigen 16 protein|pf20 protein homolog|sperm-associated WD repeat protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Spag16, check out the Spag16 Infographic

Spag16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Spag16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N0X2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPAG16 (NM_001025436) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPAG16 (NM_001025436) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPAG16 (NM_001025436) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N0X2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.