ZNF784 (NM_203374) Human Recombinant Protein

ZNF784 protein,

Recombinant protein of human zinc finger protein 784 (ZNF784)

Product Info Summary

SKU: PROTQ8NCA9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ZNF784 (NM_203374) Human Recombinant Protein

View all ZNF784 recombinant proteins

SKU/Catalog Number

PROTQ8NCA9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc finger protein 784 (ZNF784)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ZNF784 (NM_203374) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NCA9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.1 kDa

Amino Acid Sequence

MAAARPEAQSRSSPTPESRSQEPLDLVLVPDDCRPGTPPSDLIEIQVVKVTDTTLVPEPPEPGSFHCALCPAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFHGPGPGLGDSGGQLGSSAAEGSGSGCGVGDPAEEGRGETAKVKVEADQ

Validation Images & Assay Conditions

Gene/Protein Information For ZNF784 (Source: Uniprot.org, NCBI)

Gene Name

ZNF784

Full Name

Zinc finger protein 784

Weight

34.1 kDa

Superfamily

krueppel C2H2-type zinc-finger protein family

Alternative Names

MGC75238; zinc finger protein 784 ZNF784 zinc finger protein 784 zinc finger protein 784

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNF784, check out the ZNF784 Infographic

ZNF784 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNF784: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NCA9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ZNF784 (NM_203374) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ZNF784 (NM_203374) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ZNF784 (NM_203374) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NCA9
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.