Product Info Summary
SKU: | PROTP11117 |
---|---|
Size: | 20 µg |
Source: | HEK293T |
Customers Who Bought This Also Bought
Product info
Product Name
Acid Phosphatase 2 (ACP2) (NM_001610) Human Recombinant Protein
View all ACP2 recombinant proteins
SKU/Catalog Number
PROTP11117
Size
20 µg
Tag
C-Myc/DDK
Description
Purified recombinant protein of Homo sapiens acid phosphatase 2, lysosomal (ACP2), transcript variant 1
Storage & Handling
Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Cite This Product
Acid Phosphatase 2 (ACP2) (NM_001610) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP11117)
Form
Frozen Solution in PBS Buffer
Formulation
25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Concentration
>50 ug/mL as determined by microplate BCA method
Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Predicted MW
48.344kDa
Amino Acid Sequence
MAGKRIRLEPGGSPPAPSRREPGGDAAHPGPESALRYLAVPPWRPFTSEDISQGPLSGRRMAPGVWSVNQGGDATALGTGPGPAAALSRLPKHLLSPARGLCAKHRL*PDSHEC*GQPGWTLPSQRDAALQPEHLVAAYSCAHCAHH*GQAAEVPVGPMSPL*AAAERDPADTRVSE*EFSECTISGHGGQRDRAYRPDTGDRLECL*HTLL*ANARAAPAALGLTPNHAASQPAKGLQLPLPLRNLPAGGEGPASGGSPAGSDKEEPDPNGDHLPAPQAAGLLCARHYPGCPANGTGCLQW*TSPLRLLPHI*TVPGRFWEFLSGDVLSERE*QGPLAAQPAWLPSPLPTAGLPSPHRARRAQGLAAGVPAGKRSCRHRGDCGLGCMWLHPLPPHSAAPHRPLPDAGPASWLPPRRRWGGPRXAssay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Coomassie blue staining of purified ACP2 protein. The protein was produced from HEK293T cells transfected with ACP2 cDNA clone.
Protein Target Info & Infographic
Gene/Protein Information For ACP2 (Source: Uniprot.org, NCBI)
Gene Name
ACP2
Full Name
Lysosomal acid phosphatase
Weight
48.344kDa
Superfamily
histidine acid phosphatase family
Alternative Names
acid phosphatase 2, lysosomal; EC 3.1.3.2; LAP; lysosomal acid phosphatase ACP2 LAP acid phosphatase 2, lysosomal lysosomal acid phosphatase
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on ACP2, check out the ACP2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ACP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Acid Phosphatase 2 (ACP2) (NM_001610) Human Recombinant Protein (PROTP11117)
Hello CJ!
No publications found for PROTP11117
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Acid Phosphatase 2 (ACP2) (NM_001610) Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Acid Phosphatase 2 (ACP2) (NM_001610) Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question