ASF1B (NM_018154) Human Recombinant Protein

ASF1B protein,

Product Info Summary

SKU: PROTQ9NVP2
Size: 20 µg
Source: HEK293T

Product Name

ASF1B (NM_018154) Human Recombinant Protein

View all ASF1B recombinant proteins

SKU/Catalog Number

PROTQ9NVP2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (ASF1B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ASF1B (NM_018154) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NVP2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.3 kDa

Amino Acid Sequence

MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

Validation Images & Assay Conditions

Gene/Protein Information For ASF1B (Source: Uniprot.org, NCBI)

Gene Name

ASF1B

Full Name

Histone chaperone ASF1B

Weight

22.3 kDa

Superfamily

ASF1 family

Alternative Names

ASF1 silencing function 1 homolog B (S. cerevisiae); CCG1-interacting factor A-II; CIA-II; FLJ10604; hAsf1; hAsf1b; hCIA-II; histone chaperone ASF1B; silencing function protein 1 homolog B ASF1B CIA-II anti-silencing function 1B histone chaperone histone chaperone ASF1B|ASF1 anti-silencing function 1 homolog B|CCG1-interacting factor A-II|anti-silencing function protein 1 homolog B|hAsf1|hAsf1b|hCIA-II

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ASF1B, check out the ASF1B Infographic

ASF1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ASF1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NVP2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ASF1B (NM_018154) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ASF1B (NM_018154) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ASF1B (NM_018154) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NVP2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.