ATP5PF (NM_001685) Human Recombinant Protein

ATP5PF protein,

Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 (ATP5J), nuclear gene encoding mitochondrial protein, transcript variant 2

Product Info Summary

SKU: PROTP18859
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ATP5PF (NM_001685) Human Recombinant Protein

View all ATP5PF recombinant proteins

SKU/Catalog Number

PROTP18859

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 (ATP5J), nuclear gene encoding mitochondrial protein, transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ATP5PF (NM_001685) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP18859)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.9 kDa

Amino Acid Sequence

MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Validation Images & Assay Conditions

Gene/Protein Information For ATP5PF (Source: Uniprot.org, NCBI)

Gene Name

ATP5PF

Full Name

ATP synthase-coupling factor 6, mitochondrial

Weight

8.9 kDa

Superfamily

eukaryotic ATPase subunit F6 family

Alternative Names

ATP synthase-coupling factor 6, mitochondrial ATP5PF ATP5, ATP5A, ATP5J, ATPM, CF6, F6 ATP synthase peripheral stalk subunit F6 ATP synthase-coupling factor 6, mitochondrial|ATP synthase subunit h|ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6|ATP synthase, H+ transporting, mitochondrial Fo complex subunit F6|ATPase subunit F6|coupling factor 6|mitochondrial ATP synthase, coupling factor 6|mitochondrial ATP synthase, subunit F6|mitochondrial ATPase coupling factor 6|proliferation-inducing protein 36

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ATP5PF, check out the ATP5PF Infographic

ATP5PF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATP5PF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP18859

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ATP5PF (NM_001685) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ATP5PF (NM_001685) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ATP5PF (NM_001685) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP18859
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.