ATP6V1G3 (NM_133262) Human Recombinant Protein

ATP6V1G3 protein,

Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1

Product Info Summary

SKU: PROTQ96LB4
Size: 20 µg
Source: HEK293T

Product Name

ATP6V1G3 (NM_133262) Human Recombinant Protein

View all ATP6V1G3 recombinant proteins

SKU/Catalog Number

PROTQ96LB4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ATP6V1G3 (NM_133262) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96LB4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.917kDa

Amino Acid Sequence

MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Validation Images & Assay Conditions

Gene/Protein Information For ATP6V1G3 (Source: Uniprot.org, NCBI)

Gene Name

ATP6V1G3

Full Name

V-type proton ATPase subunit G 3

Weight

13.917kDa

Superfamily

V-ATPase G subunit family

Alternative Names

ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3; H+ transporting, lysosomal (vacuolar proton pump) subunit G3; MGC119810; MGC119813; vacuolar ATP synthase subunit G 3; vacuolar proton pump G subunit 3; Vacuolar proton pump subunit G 3; vacuolar proton pump, subunit G3; V-ATPase 13 kDa subunit 3; V-ATPase G subunit 3; V-ATPase G3 subunit; V-ATPase subunit G 3; V-type proton ATPase subunit G 3 ATP6V1G3 ATP6G3, Vma10 ATPase H+ transporting V1 subunit G3 V-type proton ATPase subunit G 3|ATPase, H+ transporting, lysosomal (vacuolar proton pump) subunit G3|ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3|V-ATPase 13 kDa subunit 3|V-ATPase G subunit 3|V-ATPase G3 subunit|V-ATPase subunit G 3|vacuolar ATP synthase subunit G 3|vacuolar proton pump G subunit 3|vacuolar proton pump subunit G 3|vacuolar proton pump, subunit G3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ATP6V1G3, check out the ATP6V1G3 Infographic

ATP6V1G3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATP6V1G3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96LB4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ATP6V1G3 (NM_133262) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ATP6V1G3 (NM_133262) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ATP6V1G3 (NM_133262) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96LB4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.