Anti-UCP2 Antibody Picoband™

UCP2 antibody

Boster Bio Anti-UCP2 Antibody Picoband™ catalog # A02256-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: A02256-1
Size: 100ug/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-UCP2 Antibody Picoband™

View all UCP2 Antibodies

SKU/Catalog Number

A02256-1

Size

100ug/vial

Form

Lyophilized

Description

Boster Bio Anti-UCP2 Antibody Picoband™ catalog # A02256-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-UCP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02256-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A02256-1 is reactive to UCP2 in Human, Mouse, Rat

Applications

A02256-1 is guaranteed for WB Boster Guarantee

Background of UCP2

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For UCP2 (Source: Uniprot.Org, NCBI)

Uniprot ID

P55851

Gene ID

7351

Gene Name

UCP2

Full Name

Mitochondrial uncoupling protein 2

Weight

33.229kDa

Superfamily

mitochondrial carrier (TC 2.A.29) family

Alternative Names

mitochondrial uncoupling protein 2; SLC25A8; SLC25A8BMIQ4; Solute carrier family 25 member 8; UCP 2; UCP2; UCPH; uncoupling protein 2 (mitochondrial, proton carrier) UCP2 BMIQ4, SLC25A8, UCPH uncoupling protein 2 mitochondrial uncoupling protein 2|solute carrier family 25 member 8|uncoupling protein 2 (mitochondrial, proton carrier)

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on UCP2, check out the UCP2 Infographic

UCP2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for UCP2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A02256-1 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Exhaustive Training Increases Uncoupling Protein 2 Expression and Decreases Bcl-2/Bax Ratio in Rat Skeletal Muscle

Have you used Anti-UCP2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-UCP2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-UCP2 Antibody Picoband™

Question

Our team were content with the WB result of your anti-UCP2 antibody. However we have observed positive staining in oviduct epithelium mitochondrion inner membrane using this antibody. Is that expected? Could you tell me where is UCP2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-04-30

Answer

From what I have seen in literature, oviduct epithelium does express UCP2. Generally UCP2 expresses in mitochondrion inner membrane. Regarding which tissues have UCP2 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Lung, and Skeletal muscle, Pubmed ID: 9054939
Placenta, Pubmed ID: 10082652
Skeletal muscle, Pubmed ID: 9180264
Spleen, Pubmed ID: 9133562

Boster Scientific Support

Answered: 2020-04-30

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung skeletal muscle using anti-UCP2 antibody A02256-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-04-29

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-29

Question

See below the WB image, lot number and protocol we used for lung skeletal muscle using anti-UCP2 antibody A02256-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-02-28

Question

Is there a BSA free version of anti-UCP2 antibody A02256-1 available?

Verified Customer

Verified customer

Asked: 2019-12-23

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-UCP2 antibody A02256-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-23

Question

My lab would like to test anti-UCP2 antibody A02256-1 on rat lung skeletal muscle for research purposes, then I may be interested in using anti-UCP2 antibody A02256-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-08-13

Answer

The products we sell, including anti-UCP2 antibody A02256-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-08-13

Question

We have seen staining in human lung skeletal muscle. Any tips? Is anti-UCP2 antibody supposed to stain lung skeletal muscle positively?

Verified Customer

Verified customer

Asked: 2019-08-07

Answer

Based on literature lung skeletal muscle does express UCP2. Based on Uniprot.org, UCP2 is expressed in oviduct epithelium, skeletal muscle, lung skeletal muscle, spleen, placenta, adipose tissue, b-cell, among other tissues. Regarding which tissues have UCP2 expression, here are a few articles citing expression in various tissues:
B-cell, Pubmed ID: 15489334
Lung, and Skeletal muscle, Pubmed ID: 9054939
Placenta, Pubmed ID: 10082652
Skeletal muscle, Pubmed ID: 9180264
Spleen, Pubmed ID: 9133562

Boster Scientific Support

Answered: 2019-08-07

Question

Can you help my question with product A02256-1, anti-UCP2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-06-26

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A02256-1 anti-UCP2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-06-26

Question

Will anti-UCP2 antibody A02256-1 work for WB with lung skeletal muscle?

Verified Customer

Verified customer

Asked: 2019-06-11

Answer

According to the expression profile of lung skeletal muscle, UCP2 is highly expressed in lung skeletal muscle. So, it is likely that anti-UCP2 antibody A02256-1 will work for WB with lung skeletal muscle.

Boster Scientific Support

Answered: 2019-06-11

Question

We are currently using anti-UCP2 antibody A02256-1 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2018-06-05

Answer

The anti-UCP2 antibody (A02256-1) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-06-05

Question

Our lab want to know about using your anti-UCP2 antibody for positive regulation of cold-induced thermogenesis studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2017-11-27

Answer

Thank you for your inquiry. This A02256-1 anti-UCP2 antibody is validated on rat spleen tissue, tissue lysate, cardiac muscle tissue, brain tissue, mouse spleen tissue, human hela, hela whole cell lysate. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-11-27

Question

Is this A02256-1 anti-UCP2 antibody reactive to the isotypes of UCP2?

Verified Customer

Verified customer

Asked: 2017-08-22

Answer

The immunogen of A02256-1 anti-UCP2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-08-22

Question

Will A02256-1 anti-UCP2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

J. Wu

Verified customer

Asked: 2017-02-06

Answer

As indicated on the product datasheet, A02256-1 anti-UCP2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-02-06

Question

I was wanting to use your anti-UCP2 antibody for WB for rat lung skeletal muscle on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat lung skeletal muscle identification?

R. Krishna

Verified customer

Asked: 2016-07-21

Answer

As indicated on the product datasheet, A02256-1 anti-UCP2 antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat lung skeletal muscle in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-07-21

Question

I see that the anti-UCP2 antibody A02256-1 works with WB, what is the protocol used to produce the result images on the product page?

D. Kulkarni

Verified customer

Asked: 2014-10-08

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-10-08

Question

Is a blocking peptide available for product anti-UCP2 antibody (A02256-1)?

L. Yang

Verified customer

Asked: 2013-03-13

Answer

We do provide the blocking peptide for product anti-UCP2 antibody (A02256-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2013-03-13

Conjugation

how to order through PO

Size

Total: $315

Size:100ug

SKU:A02256-1

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A02256-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.