Cadherin like 23 (CDH23) (NM_052836) Human Recombinant Protein

Cadherin-23 protein,

Recombinant protein of human cadherin-like 23 (CDH23), transcript variant 2

Product Info Summary

SKU: PROTQ9H251
Size: 20 µg
Source: HEK293T

Product Name

Cadherin like 23 (CDH23) (NM_052836) Human Recombinant Protein

View all Cadherin-23 recombinant proteins

SKU/Catalog Number

PROTQ9H251

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cadherin-like 23 (CDH23), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

Cadherin like 23 (CDH23) (NM_052836) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H251)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

369.623kDa

Amino Acid Sequence

MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLVSPRFTAGPLSSPGPTVVRHPEGFCPRDLSNQGRRHPQIPELCLLVY

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For Cdh23 (Source: Uniprot.org, NCBI)

Gene Name

Cdh23

Full Name

Cadherin-23

Weight

369.623kDa

Alternative Names

cadherin related 23; cadherin-23; cadherin-like 23; cadherin-related 23; cadherin-related family member 23; CDHR23; DKFZp434P2350; FLJ00233; FLJ36499; KIAA1774; KIAA1812; MGC102761; otocadherin; USH1D Cdh23|4930542A03Rik, USH1, USH1D, a, ahl, ahl1, bo, bob, bus, mdfw, nmf11, nmf112, nmf18, nmf181, nmf25, nmf252, sals, v|cadherin 23 (otocadherin)|cadherin-23|age related hearing loss 1|bobby|bustling|modifier of deaf waddler|otocadherin|waltzer

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Cdh23, check out the Cdh23 Infographic

Cdh23 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Cdh23: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H251

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Cadherin like 23 (CDH23) (NM_052836) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Cadherin like 23 (CDH23) (NM_052836) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Cadherin like 23 (CDH23) (NM_052836) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
Eddy test
In stock
Order Product
PROTQ9H251
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.