CHTF8 (NM_001039690) Human Recombinant Protein

CHTF8 protein,

Recombinant protein of human CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 1

Product Info Summary

SKU: PROTP0CG13
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CHTF8 (NM_001039690) Human Recombinant Protein

View all CHTF8 recombinant proteins

SKU/Catalog Number

PROTP0CG13

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CHTF8 (NM_001039690) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0CG13)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.1 kDa

Amino Acid Sequence

MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPFAVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV

Validation Images & Assay Conditions

Gene/Protein Information For CHTF8 (Source: Uniprot.org, NCBI)

Gene Name

CHTF8

Full Name

Chromosome transmission fidelity protein 8 homolog

Weight

13.1 kDa

Superfamily

CTF8 family

Alternative Names

chromosome transmission fidelity protein 8 homolog; CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae); CTF8hCTF8; Decreased expression in renal and prostate cancer protein; DERPCchromosome transmission fidelity factor 8 homolog; FLJ20400 CHTF8 CTF8, DERPC chromosome transmission fidelity factor 8 chromosome transmission fidelity protein 8 homolog|CTF8, chromosome transmission fidelity factor 8 homolog|decreased expression in renal and prostate cancer protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CHTF8, check out the CHTF8 Infographic

CHTF8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CHTF8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0CG13

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CHTF8 (NM_001039690) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CHTF8 (NM_001039690) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CHTF8 (NM_001039690) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0CG13
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.