COP1 (RFWD2) (NM_001001740) Human Recombinant Protein

Cop1 protein,

Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 2

Product Info Summary

SKU: PROTQ8NHY2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

COP1 (RFWD2) (NM_001001740) Human Recombinant Protein

View all Cop1 recombinant proteins

SKU/Catalog Number

PROTQ8NHY2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ring finger and WD repeat domain 2 (RFWD2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

COP1 (RFWD2) (NM_001001740) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NHY2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

80.441kDa

Amino Acid Sequence

MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV

Validation Images & Assay Conditions

Gene/Protein Information For Cop1 (Source: Uniprot.org, NCBI)

Gene Name

Cop1

Full Name

E3 ubiquitin-protein ligase COP1

Weight

80.441kDa

Superfamily

COP1 family

Alternative Names

E3 ubiquitin-protein ligase COP1 Cop1|AI316802, C80879, Co, Rfwd, Rfwd2|COP1, E3 ubiquitin ligase|E3 ubiquitin-protein ligase COP1|E3 ubiquitin-protein ligase RFWD2|RING finger and WD repeat domain protein 2|RING-type E3 ubiquitin transferase RFWD2|constitutive photomorphogenesis protein 1 homolog|constitutive photomorphogenic protein 1|mCOP1|ring finger and WD repeat domain 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Cop1, check out the Cop1 Infographic

Cop1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Cop1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NHY2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used COP1 (RFWD2) (NM_001001740) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For COP1 (RFWD2) (NM_001001740) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for COP1 (RFWD2) (NM_001001740) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NHY2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.