FBXO27 (NM_178820) Human Recombinant Protein

FBXO27 protein,

Recombinant protein of human F-box protein 27 (FBXO27)

Product Info Summary

SKU: PROTQ8NI29
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FBXO27 (NM_178820) Human Recombinant Protein

View all FBXO27 recombinant proteins

SKU/Catalog Number

PROTQ8NI29

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human F-box protein 27 (FBXO27)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FBXO27 (NM_178820) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NI29)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

31.623kDa

Amino Acid Sequence

MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS

Validation Images & Assay Conditions

Gene/Protein Information For FBXO27 (Source: Uniprot.org, NCBI)

Gene Name

FBXO27

Full Name

F-box only protein 27

Weight

31.623kDa

Alternative Names

Fbg5; FBG5FBX27; F-box only protein 27; F-box protein 27; F-box protein FBG5; F-box/G-domain protein 5; Fbx27 FBXO27 FBG5, Fbx27 F-box protein 27 F-box only protein 27|F-box protein FBG5|F-box/G-domain protein 5|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FBXO27, check out the FBXO27 Infographic

FBXO27 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FBXO27: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NI29

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FBXO27 (NM_178820) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FBXO27 (NM_178820) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FBXO27 (NM_178820) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NI29
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.