GSTM4 (NM_000850) Human Recombinant Protein

GSTM4 protein,

Product Info Summary

SKU: PROTQ03013
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

GSTM4 (NM_000850) Human Recombinant Protein

View all GSTM4 recombinant proteins

SKU/Catalog Number

PROTQ03013

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human glutathione S-transferase mu 4 (GSTM4), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GSTM4 (NM_000850) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ03013)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.4 kDa

Amino Acid Sequence

MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK

Validation Images & Assay Conditions

Gene/Protein Information For GSTM4 (Source: Uniprot.org, NCBI)

Gene Name

GSTM4

Full Name

Glutathione S-transferase Mu 4

Weight

25.4 kDa

Superfamily

GST superfamily

Alternative Names

EC 2.5.1.18; glutathione S-alkyltransferase M4; glutathione S-aralkyltransferase M4; glutathione S-aryltransferase M4; glutathione S-transferase M4; glutathione S-transferase mu 4; GST class-mu 4; GSTM4-4; GST-Mu2; GTM4; GTS-Mu2; MGC131945; MGC9247; S-(hydroxyalkyl)glutathione lyase M4 GSTM4 GSTM4-4, GTM4 glutathione S-transferase mu 4 glutathione S-transferase Mu 4|GST class-mu 4|GST-Mu2|GTS-Mu2|S-(hydroxyalkyl)glutathione lyase M4|glutathione S-alkyltransferase M4|glutathione S-aralkyltransferase M4|glutathione S-aryltransferase M4|glutathione S-transferase M4|leukotriene C4 synthase GSTM4|testis tissue sperm-binding protein Li 60n

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GSTM4, check out the GSTM4 Infographic

GSTM4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GSTM4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ03013

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GSTM4 (NM_000850) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GSTM4 (NM_000850) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GSTM4 (NM_000850) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ03013
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.