Product Info Summary
| SKU: | PROTQ49AH0-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant CDNF (Cerebral dopamine neurotrophic factor) protein, AF
View all CDNF recombinant proteins
SKU/Catalog Number
PROTQ49AH0-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Cerebral dopamine neurotrophic factor (CDNF) also known as ARMETL1, which is a member of ARMET family. CDNF is a 20.9 kDa neurotrophic factor containing 187 residues that widely expressed in various tissues, including embryonic and postnatal brain. Besides, CDNF shows the ability to protect the degeneration of dopaminergic neurons in Parkinson’s disease, induced by 6-hydroxydopamine (6-OHDA). Moreover, as a neurotrophic factor, CDNF also can repair the dopaminergic function of dopaminergic neurons.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant CDNF (Cerebral dopamine neurotrophic factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ49AH0-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
21.0 kDa
Molecular weight
The protein has a calculated MW of 19.26 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human CDNF
Specific Publications For Human recombinant CDNF (Cerebral dopamine neurotrophic factor) protein, AF (PROTQ49AH0-2)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant CDNF (Cerebral dopamine neurotrophic factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant CDNF (Cerebral dopamine neurotrophic factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
