Click image to see more details
Product Info Summary
| SKU: | PROTQ99062-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF
View all CSF3R recombinant proteins
SKU/Catalog Number
PROTQ99062-3
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins and makes the bone marrow produce more white blood cells so it can reduce the risk of infection after some types of cancer treatment also is an established useful clinical agent for increasing neutrophilic granulocytes levels. G-CSF is a 18.67 kDa protein having 207 amino acid which secreted by monocytes, macrophages, fibroblasts, and endothelial cells, regulates cell growth, maturation, development of myeloid cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99062-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
92.2 kDa
Molecular weight
The protein has a calculated MW of 19.48 kDa. The protein migrates as 21kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant human G-CSF is > 2 x 10⁷ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human G-CSF
Specific Publications For Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF (PROTQ99062-3)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant G-CSF (Granulocyte colony-stimulating factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
