Click image to see more details
Product Info Summary
| SKU: | PROTO95150-5 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Human recombinant TL1A (TNF-like ligand 1A) protein, AF
View all TNFSF15 recombinant proteins
SKU/Catalog Number
PROTO95150-5
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
TL1A also known as VEGI and TNFSF15, which belongs to TNF ligand superfamily. TL1A is a 28 kDa type II membrane protein containing 251 residues that predominantly expressed in endothelial cells. TL1A is able to promote NFκB activation in cells by interacting with DR3. Besides, TL1A can also induces cell apoptosis through activating caspases. Additionally, the responsiveness of IL-2 from activated T cells has been shown to induce by TL1A treatment.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant TL1A (TNF-like ligand 1A) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95150-5)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
28.1 kDa
Molecular weight
The protein has a calculated MW of 22.95 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL with polyhistidine tag at the C-terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human TL1A
Specific Publications For Human recombinant TL1A (TNF-like ligand 1A) protein, AF (PROTO95150-5)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant TL1A (TNF-like ligand 1A) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant TL1A (TNF-like ligand 1A) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
