Human recombinant TL1A (TNF-like ligand 1A) protein, AF

TNFSF15 protein, Human

TL1A also known as VEGI and TNFSF15, which belongs to TNF ligand superfamily. TL1A is a 28 kDa type II membrane protein containing 251 residues that predominantly expressed in endothelial cells. TL1A is able to promote NFκB activation in cells by interacting with DR3. Besides, TL1A can also induces cell apoptosis through activating caspases. Additionally, the responsiveness of IL-2 from activated T cells has been shown to induce by TL1A treatment.

Product Info Summary

SKU: PROTO95150-5
Size: 5ug,20ug,100ug
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant TL1A (TNF-like ligand 1A) protein, AF

View all TNFSF15 recombinant proteins

SKU/Catalog Number

PROTO95150-5

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

TL1A also known as VEGI and TNFSF15, which belongs to TNF ligand superfamily. TL1A is a 28 kDa type II membrane protein containing 251 residues that predominantly expressed in endothelial cells. TL1A is able to promote NFκB activation in cells by interacting with DR3. Besides, TL1A can also induces cell apoptosis through activating caspases. Additionally, the responsiveness of IL-2 from activated T cells has been shown to induce by TL1A treatment.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant TL1A (TNF-like ligand 1A) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95150-5)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

28.1 kDa

Molecular weight

The protein has a calculated MW of 22.95 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL with polyhistidine tag at the C-terminus

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Human recombinant TL1A (TNF-like ligand 1A) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant TL1A (TNF-like ligand 1A) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant TL1A (TNF-like ligand 1A) protein, AF

Size

Total: $77.00

SKU:PROTO95150-5

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTO95150-5
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 25, 2026