MARVELD1 (NM_031484) Human Recombinant Protein

MARVELD1 protein,

Recombinant protein of human MARVEL domain containing 1 (MARVELD1).

Product Info Summary

SKU: PROTQ9BSK0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MARVELD1 (NM_031484) Human Recombinant Protein

View all MARVELD1 recombinant proteins

SKU/Catalog Number

PROTQ9BSK0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MARVEL domain containing 1 (MARVELD1).

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MARVELD1 (NM_031484) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BSK0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0194kDa

Amino Acid Sequence

MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIATSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVAHDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVCHGLYLLSALYGCGRRCQGKQEVA

Validation Images & Assay Conditions

Gene/Protein Information For MARVELD1 (Source: Uniprot.org, NCBI)

Gene Name

MARVELD1

Full Name

MARVEL domain-containing protein 1

Weight

0.0194kDa

Alternative Names

MARVEL domain-containing protein 1 MARVELD1 GB14, MARVD1, MRVLDC1, bA548K23.8 MARVEL domain containing 1 MARVEL domain-containing protein 1|MARVEL (membrane-associating) domain containing 1|occludin|putative MARVEL domain-containing protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MARVELD1, check out the MARVELD1 Infographic

MARVELD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MARVELD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BSK0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MARVELD1 (NM_031484) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MARVELD1 (NM_031484) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MARVELD1 (NM_031484) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BSK0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.