MIF4GD (NM_020679) Human Recombinant Protein

MIF4GD protein,

Recombinant protein of human MIF4G domain containing (MIF4GD)

Product Info Summary

SKU: PROTA9UHW6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MIF4GD (NM_020679) Human Recombinant Protein

View all MIF4GD recombinant proteins

SKU/Catalog Number

PROTA9UHW6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MIF4G domain containing (MIF4GD)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MIF4GD (NM_020679) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA9UHW6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.2 kDa

Amino Acid Sequence

MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

Validation Images & Assay Conditions

Gene/Protein Information For MIF4GD (Source: Uniprot.org, NCBI)

Gene Name

MIF4GD

Full Name

MIF4G domain-containing protein

Weight

29.2 kDa

Superfamily

MIF4GD family

Alternative Names

AD023; hSLIP1; MGC45027; MIF4G domain containing; MIFD; SLBP (stem loop binding protein)-interacting protein 1; SLBP-interacting protein 1; SLIP1MIF4G domain-containing protein MIF4GD AD023, MIFD, SLIP1 MIF4G domain containing MIF4G domain-containing protein|SLBP (stem loop binding protein)-interacting protein 1|SLBP-interacting protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MIF4GD, check out the MIF4GD Infographic

MIF4GD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MIF4GD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA9UHW6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MIF4GD (NM_020679) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MIF4GD (NM_020679) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MIF4GD (NM_020679) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA9UHW6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.