NDUFA5 (NM_005000) Human Recombinant Protein

NDUFA5 protein,

Product Info Summary

SKU: PROTQ16718
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NDUFA5 (NM_005000) Human Recombinant Protein

View all NDUFA5 recombinant proteins

SKU/Catalog Number

PROTQ16718

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa (NDUFA5), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDUFA5 (NM_005000) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16718)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.3 kDa

Amino Acid Sequence

MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Validation Images & Assay Conditions

Gene/Protein Information For NDUFA5 (Source: Uniprot.org, NCBI)

Gene Name

NDUFA5

Full Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

Weight

13.3 kDa

Superfamily

complex I NDUFA5 subunit family

Alternative Names

B13,5 (13kD, B13); DKFZp781K1356; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa; UQOR13FLJ12147 NDUFA5 B13, CI-13KD-B, CI-13kB, NUFM, UQOR13 NADH:ubiquinone oxidoreductase subunit A5 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5|NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa|NADH-ubiquinone oxidoreductase 13 kDa-B subunit|complex I 13kDa subunit B|complex I subunit B13|type I dehydrogenase|ubiquinone reductase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDUFA5, check out the NDUFA5 Infographic

NDUFA5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDUFA5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16718

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDUFA5 (NM_005000) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDUFA5 (NM_005000) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDUFA5 (NM_005000) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16718
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.