PPIH (NM_006347) Human Recombinant Protein

PPIH protein,

Product Info Summary

SKU: PROTO43447
Size: 20 µg
Source: HEK293T

Product Name

PPIH (NM_006347) Human Recombinant Protein

View all PPIH recombinant proteins

SKU/Catalog Number

PROTO43447

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human peptidylprolyl isomerase H (cyclophilin H) (PPIH)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPIH (NM_006347) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43447)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19 kDa

Amino Acid Sequence

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Validation Images & Assay Conditions

Gene/Protein Information For PPIH (Source: Uniprot.org, NCBI)

Gene Name

PPIH

Full Name

Peptidyl-prolyl cis-trans isomerase H

Weight

19 kDa

Superfamily

cyclophilin-type PPIase family

Alternative Names

cyclophilin H; CYP20; CypH; CYPHpeptidyl prolyl isomerase H (cyclophilin H); EC 5.2.1.8; MGC5016; peptidyl-prolyl cis-trans isomerase H; peptidylprolyl isomerase H (cyclophilin H); PPIase H; Rotamase H; Small nuclear ribonucleoprotein particle-specific cyclophilin H; SnuCyp-20; USA-CyP SnuCyp-20; USA-CYPCYP-20; U-snRNP-associated cyclophilin SnuCyp-20; U-snRNP-associated cyclophilin SunCyp-20 PPIH CYP-20, CYPH, SnuCyp-20, USA-CYP peptidylprolyl isomerase H peptidyl-prolyl cis-trans isomerase H|PPIase h|U-snRNP-associated cyclophilin SnuCyp-20|U-snRNP-associated cyclophilin SunCyp-20|USA-CyP SnuCyp-20|cyclophilin H|rotamase H|small nuclear ribonucleoprotein particle-specific cyclophilin H

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPIH, check out the PPIH Infographic

PPIH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPIH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43447

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPIH (NM_006347) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPIH (NM_006347) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPIH (NM_006347) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43447
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.