RABIF (NM_002871) Human Recombinant Protein

RABIF/MSS4 protein,

Product Info Summary

SKU: PROTP47224
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RABIF (NM_002871) Human Recombinant Protein

View all RABIF/MSS4 recombinant proteins

SKU/Catalog Number

PROTP47224

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB interacting factor (RABIF)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RABIF (NM_002871) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP47224)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.7 kDa

Amino Acid Sequence

MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE

Validation Images & Assay Conditions

Gene/Protein Information For RABIF (Source: Uniprot.org, NCBI)

Gene Name

RABIF

Full Name

Guanine nucleotide exchange factor MSS4

Weight

13.7 kDa

Superfamily

DSS4/MSS4 family

Alternative Names

mammalian suppressor of SEC4; mss4; MSS4guanine nucleotide exchange factor MSS4; RAB interacting factor; Rab-interacting factor; RASGFR3; RASGRF3; Ras-specific guanine-releasing factor 3 RABIF MSS4, RASGFR3, RASGRF3 RAB interacting factor guanine nucleotide exchange factor MSS4|Ras-specific guanine-releasing factor 3|mammalian suppressor of SEC4|rab-interacting factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RABIF, check out the RABIF Infographic

RABIF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RABIF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP47224

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RABIF (NM_002871) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RABIF (NM_002871) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RABIF (NM_002871) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP47224
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.