Product Info Summary
| SKU: | PROTP23563-1 |
|---|---|
| Size: | 5ug,20ug |
| Origin Species: | Swine |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Product info
Product Name
Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF
View all TNF recombinant proteins
SKU/Catalog Number
PROTP23563-1
Size
5ug,20ug
Tag
His Tag (C-term)
Description
Tumor necrosis factor alpha (TNF alpha) stimulates the acute phase of the immune response. In response to a pathogen, TNF alpha is one of the first to be released and can apply its effects in many organs. TNF alpha stimulates the release of corticotropic releasing hormone, suppresses appetite, and induces fever, in the hypothalamus. TNF increase vasodilation and loss of vascular permeability, it helps recruit lymphocyte, neutrophil, and monocyte to the inflammation site by regulating chemokine release.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP23563-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Molecular weight
The protein has a calculated MW of 18.1 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED₅₀ for this effect is <15 pg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine TNF alpha
Specific Publications For Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF (PROTP23563-1)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question

