Tetranectin (CLEC3B) (NM_003278) Human Recombinant Protein

CLEC3B/Tetranectin protein,

Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B)

Product Info Summary

SKU: PROTP05452
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Tetranectin (CLEC3B) (NM_003278) Human Recombinant Protein

View all CLEC3B/Tetranectin recombinant proteins

SKU/Catalog Number

PROTP05452

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Tetranectin (CLEC3B) (NM_003278) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05452)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.4 kDa

Amino Acid Sequence

MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

Validation Images & Assay Conditions

Gene/Protein Information For CLEC3B (Source: Uniprot.org, NCBI)

Gene Name

CLEC3B

Full Name

Tetranectin

Weight

22.4 kDa

Alternative Names

CLEC3B; C-type lectin domain family 3 member B; C-type lectin domain family 3, member B; DKFZp686H17246; Plasminogen kringle 4-binding protein; TETN; tetranectin (plasminogen binding protein); Tetranectin; TNA; TNAtetranectin (plasminogen-binding protein); TNtetranectin CLEC3B TN, TNA C-type lectin domain family 3 member B tetranectin|plasminogen kringle 4-binding protein|tetranectin (plasminogen-binding protein)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLEC3B, check out the CLEC3B Infographic

CLEC3B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLEC3B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP05452

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Tetranectin (CLEC3B) (NM_003278) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Tetranectin (CLEC3B) (NM_003278) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Tetranectin (CLEC3B) (NM_003278) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP05452
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.