Activin Receptor Type IA (ACVR1) (NM_001105) Human Recombinant Protein

Activin RIA/ALK-2/Activin Receptor Type 1 protein,

Product Info Summary

SKU: PROTQ04771
Size: 20 µg
Source: HEK293T

Product Name

Activin Receptor Type IA (ACVR1) (NM_001105) Human Recombinant Protein

View all Activin RIA/ALK-2/Activin Receptor Type 1 recombinant proteins

SKU/Catalog Number

PROTQ04771

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human activin A receptor, type I (ACVR1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Activin Receptor Type IA (ACVR1) (NM_001105) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ04771)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

55 kDa

Amino Acid Sequence

MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Validation Images & Assay Conditions

Gene/Protein Information For ACVR1 (Source: Uniprot.org, NCBI)

Gene Name

ACVR1

Full Name

Activin receptor type-1

Weight

55 kDa

Superfamily

protein kinase superfamily

Alternative Names

activin A receptor, type I; Activin RIA; ActivinRIA; ACTRI; ACVR1; ACVR1A; ACVRLK2; ALK2; ALK-2; FOP; SKR1; TSRI ACVR1 ACTRIA, ACVRLK2, ALK2, FOP, SKR1, TSRI, ACVR1 activin A receptor type 1 activin receptor type-1|TGF-B superfamily receptor type I|activin A receptor, type I|activin A receptor, type II-like kinase 2|activin receptor type I|activin receptor-like kinase 2|hydroxyalkyl-protein kinase|serine/threonine-protein kinase receptor R1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ACVR1, check out the ACVR1 Infographic

ACVR1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ACVR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ04771

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Activin Receptor Type IA (ACVR1) (NM_001105) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Activin Receptor Type IA (ACVR1) (NM_001105) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Activin Receptor Type IA (ACVR1) (NM_001105) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ04771
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.