Anti-B3GNT8 Antibody Picoband®

B3GNT8 antibody

Boster Bio Anti-B3GNT8 Antibody Picoband® catalog # PB9686. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9686
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-B3GNT8 Antibody Picoband®

View all B3GNT8 Antibodies

SKU/Catalog Number

PB9686
PB0725 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-B3GNT8 Antibody Picoband® catalog # PB9686. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-B3GNT8 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9686)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8, different from the related mouse sequence by sixteen amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9686 is reactive to B3GNT8 in Human

Observed Molecular Weight

43 kDa

Calculated molecular weight

43.4 kDa

Background of B3GNT8

B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn (2+) and showed less efficiency with Co (2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9686 is guaranteed for IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human
Western blot, 0.1-0.5μg/ml, Human

Positive Control

WB: HELA Whole Cell
IHC: human mammary cancer tissue

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-B3GNT8 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-B3GNT8 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-B3GNT8 Antibody Picoband®

Question

My question regarding product PB9686, anti-B3GNT8 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

L. Li

Verified customer

Asked: 2020-02-03

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9686 anti-B3GNT8 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-02-03

Question

We are currently using anti-B3GNT8 antibody PB9686 for human tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-29

Answer

The anti-B3GNT8 antibody (PB9686) has not been tested for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-29

Question

Would PB9686 anti-B3GNT8 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-11-07

Answer

It shows on the product datasheet, PB9686 anti-B3GNT8 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-11-07

Question

Is a blocking peptide available for product anti-B3GNT8 antibody (PB9686)?

Verified Customer

Verified customer

Asked: 2018-12-17

Answer

We do provide the blocking peptide for product anti-B3GNT8 antibody (PB9686). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2018-12-17

Question

Is this PB9686 anti-B3GNT8 antibody reactive to the isotypes of B3GNT8?

Verified Customer

Verified customer

Asked: 2018-08-02

Answer

The immunogen of PB9686 anti-B3GNT8 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-08-02

Question

I see that the anti-B3GNT8 antibody PB9686 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-06-25

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2018-06-25

Question

I was wanting to use your anti-B3GNT8 antibody for IHC for human lower esophagus mucosa on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lower esophagus mucosa identification?

Verified Customer

Verified customer

Asked: 2017-12-25

Answer

You can see on the product datasheet, PB9686 anti-B3GNT8 antibody has been tested for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lower esophagus mucosa in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-12-25

Order DetailsPrice
PB9686

100μg

$370
PB9686-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9686-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9686-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9686-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9686-APC

100 μg APC conjugated (liquid)

$820
PB9686-FITC

100 μg FITC conjugated (liquid)

$570
PB9686-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9686-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9686-HRP

100 μg HRP conjugated (liquid)

$570
PB9686-PE

100 μg PE conjugated (liquid)

$820
PB9686-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9686
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Apr 21, 2026