Product Info Summary
| SKU: | A02900 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Exportin-5/XPO5 Antibody Picoband®
SKU/Catalog Number
A02900
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Exportin-5/XPO5 Antibody Picoband® catalog # A02900. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Exportin-5/XPO5 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02900)
Host
Rabbit
Contents
Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5, different from the related mouse sequence by four amino acids.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02900 is reactive to XPO5 in Human, Mouse, Rat
Observed Molecular Weight
136 kDa
Calculated molecular weight
136.3 kDa
Background of XPO5
Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A02900 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: human Hela whole cell, human K562 whole cell, human HEL whole cell
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of Exportin-5/XPO5 using anti-Exportin-5/XPO5 antibody (A02900).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human K562 whole cell lysates,
Lane 3: human HEL whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Exportin-5/XPO5 antigen affinity purified polyclonal antibody (Catalog # A02900) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Exportin-5/XPO5 at approximately 136 kDa. The expected band size for Exportin-5/XPO5 is at 136 kDa.
Specific Publications For Anti-Exportin-5/XPO5 Antibody Picoband® (A02900)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Exportin-5/XPO5 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Exportin-5/XPO5 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-Exportin-5/XPO5 Antibody Picoband®
Question
Is this A02900 anti-Exportin-5/XPO5 antibody reactive to the isotypes of XPO5?
Verified Customer
Verified customer
Asked: 2020-04-09
Answer
The immunogen of A02900 anti-Exportin-5/XPO5 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-09
Question
Here is the WB image, lot number and protocol we used for testis using anti-Exportin-5/XPO5 antibody A02900. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-02-17
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-17
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis using anti-Exportin-5/XPO5 antibody A02900. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-02-12
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-12
Question
Is a blocking peptide available for product anti-Exportin-5/XPO5 antibody (A02900)?
M. Johnson
Verified customer
Asked: 2019-02-15
Answer
We do provide the blocking peptide for product anti-Exportin-5/XPO5 antibody (A02900). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2019-02-15
Question
I was wanting to use to test anti-Exportin-5/XPO5 antibody A02900 on human testis for research purposes, then I may be interested in using anti-Exportin-5/XPO5 antibody A02900 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-09-12
Answer
The products we sell, including anti-Exportin-5/XPO5 antibody A02900, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-09-12
Question
We are currently using anti-Exportin-5/XPO5 antibody A02900 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?
H. Li
Verified customer
Asked: 2017-12-04
Answer
The anti-Exportin-5/XPO5 antibody (A02900) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-12-04


