Anti-IL7R alpha Antibody Picoband®

IL7R antibody

Boster Bio Anti-IL7R alpha Antibody Picoband® catalog # PB9948. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9948
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: Flow Cytometry, WB

Customers Who Bought This Also Bought

Product Name

Anti-IL7R alpha Antibody Picoband®

View all IL7R Antibodies

SKU/Catalog Number

PB9948
PB0996 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-IL7R alpha Antibody Picoband® catalog # PB9948. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IL7R alpha Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9948)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha, different from the related mouse sequence by nine amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9948 is reactive to IL7R in Human, Rat

Observed Molecular Weight

70 kDa

Calculated molecular weight

51.6 kDa

Background of IL7R

The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V (D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9948 is guaranteed for Flow Cytometry, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Rat
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

IL7R antibody was positively detected by WB in:
22RV1 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
IL7R antibody was positively detected by FC in:
U20S cell, U87 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-IL7R alpha Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-IL7R alpha Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-IL7R alpha Antibody Picoband®

Question

We are currently using anti-IL7R alpha antibody PB9948 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on pig tissues as well?

K. Parker

Verified customer

Asked: 2019-08-06

Answer

The anti-IL7R alpha antibody (PB9948) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-06

Question

Is this PB9948 anti-IL7R alpha antibody reactive to the isotypes of IL7R?

Verified Customer

Verified customer

Asked: 2017-09-26

Answer

The immunogen of PB9948 anti-IL7R alpha antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-09-26

Question

PB9948 PB9199 Could you let me know if these will pass FLOW?

Verified Customer

Verified customer

Asked: 2014-12-26

Answer

PB9948 passed FLOW. PB9919 failed.

Boster Scientific Support

Answered: 2014-12-26

Order DetailsPrice
PB9948

100μg

$370
PB9948-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9948-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9948-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9948-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9948-APC

100 μg APC conjugated (liquid)

$820
PB9948-FITC

100 μg FITC conjugated (liquid)

$570
PB9948-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9948-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9948-HRP

100 μg HRP conjugated (liquid)

$570
PB9948-PE

100 μg PE conjugated (liquid)

$820
PB9948-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9948
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 24, 2026