Anti-MEF2C Antibody Picoband®

MEF2C antibody

Boster Bio Anti-MEF2C Antibody Picoband® catalog # A01131-1. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A01131-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-MEF2C Antibody Picoband®

View all MEF2C Antibodies

SKU/Catalog Number

A01131-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MEF2C Antibody Picoband® catalog # A01131-1. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MEF2C Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01131-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human MEF2C, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01131-1 is reactive to MEF2C in Human, Mouse, Rat

Observed Molecular Weight

50-65 kDa

Calculated molecular weight

51.2 kDa

Background of MEF2C

MEF2C (myocyte enhancer factor 2C), also called MADS box transcription enhancer factor 2, polypeptide C, is a protein that in humans is encoded by the MEF2C gene. MEF2C is a transcription factor in the Mef2 family. MEF2C, however, is induced late during myogenic differentiation and has a strict tissue-specific pattern of expression not seen in MEF2A or MEF2B. By fluorescence in situ hybridization, the human MEF2C is mapped to chromosome 5q14, a region with homology of synteny to the mouse location.MEF2C may be involved with maintenance of the differentiated state. Both MEF2A and Mef2c programmed similar profiles of gene expression in the heart that included genes involved in extracellular matrix remodeling, ion handling, and metabolism. NCOA2 mediates the coactivation of MEF2C-dependent transcription through interaction with the MADS box domain of MEF2C.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A01131-1 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.25-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human K562 whole cell, human COLO320 whole cell, human DAUDI whole cell, human U937 whole cell, rat brain tissue
IHC: human tonsil tissue, rat brain tissue, mouse brain tissue
FCM: HELA cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-MEF2C Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-MEF2C Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-MEF2C Antibody Picoband®

Question

We want to test anti-MEF2C antibody A01131-1 on human fetal brain muscle for research purposes, then I may be interested in using anti-MEF2C antibody A01131-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-02-05

Answer

The products we sell, including anti-MEF2C antibody A01131-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-02-05

Question

My team were happy with the WB result of your anti-MEF2C antibody. However we have observed positive staining in fetal brain muscle nucleus. using this antibody. Is that expected? Could you tell me where is MEF2C supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-02-04

Answer

From what I have seen in literature, fetal brain muscle does express MEF2C. Generally MEF2C expresses in nucleus. Regarding which tissues have MEF2C expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Fetal brain, and Muscle, Pubmed ID: 7679508
Skeletal muscle, Pubmed ID: 8455629, 17974005

Boster Scientific Support

Answered: 2020-02-04

Question

Our lab want to know about using your anti-MEF2C antibody for positive regulation of neuron differentiation studies. Has this antibody been tested with western blotting on kidney tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-01-30

Answer

Thank you for your inquiry. This A01131-1 anti-MEF2C antibody is validated on rat lung tissue, brain tissue, mouse brain, cardiac muscle tissue, spleen tissue, kidney tissue, small intestine tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-01-30

Question

I have a question about product A01131-1, anti-MEF2C antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-10-08

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01131-1 anti-MEF2C antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-10-08

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain muscle using anti-MEF2C antibody A01131-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-02

Question

I was wanting to use your anti-MEF2C antibody for IHC for human fetal brain muscle on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human fetal brain muscle identification?

Verified Customer

Verified customer

Asked: 2019-08-07

Answer

You can see on the product datasheet, A01131-1 anti-MEF2C antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human fetal brain muscle in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-07

Question

Is there a BSA free version of anti-MEF2C antibody A01131-1 available?

Verified Customer

Verified customer

Asked: 2019-07-10

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-MEF2C antibody A01131-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-07-10

Question

Is a blocking peptide available for product anti-MEF2C antibody (A01131-1)?

Verified Customer

Verified customer

Asked: 2019-06-19

Answer

We do provide the blocking peptide for product anti-MEF2C antibody (A01131-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-06-19

Question

Will A01131-1 anti-MEF2C antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-06-13

Answer

It shows on the product datasheet, A01131-1 anti-MEF2C antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-06-13

Question

We are currently using anti-MEF2C antibody A01131-1 for rat tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-07

Answer

The anti-MEF2C antibody (A01131-1) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-07

Question

I see that the anti-MEF2C antibody A01131-1 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-05-31

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-05-31

Question

We purchased anti-MEF2C antibody for WB on skeletal muscle a few years ago. I am using human, and I plan to use the antibody for IHC next. I am interested in examining skeletal muscle as well as fetal brain muscle in our next experiment. Could give a recommendation on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2018-02-27

Answer

I took a look at the website and datasheets of our anti-MEF2C antibody and I see that A01131-1 has been tested on human in both WB and IHC. Thus A01131-1 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-02-27

Question

We have been able to see staining in rat skeletal muscle. Are there any suggestions? Is anti-MEF2C antibody supposed to stain skeletal muscle positively?

B. Thomas

Verified customer

Asked: 2016-10-06

Answer

From what I have seen in literature skeletal muscle does express MEF2C. From what I have seen in Uniprot.org, MEF2C is expressed in middle temporal gyrus, fetal brain muscle, skeletal muscle, erythroleukemia, among other tissues. Regarding which tissues have MEF2C expression, here are a few articles citing expression in various tissues:
Erythroleukemia, Pubmed ID: 23186163
Fetal brain, and Muscle, Pubmed ID: 7679508
Skeletal muscle, Pubmed ID: 8455629, 17974005

Boster Scientific Support

Answered: 2016-10-06

Question

See below the WB image, lot number and protocol we used for fetal brain muscle using anti-MEF2C antibody A01131-1. Please let me know if you require anything else.

A. Gonzalez

Verified customer

Asked: 2016-06-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-06-29

Question

Would anti-MEF2C antibody A01131-1 work for IHC with fetal brain muscle?

C. Jones

Verified customer

Asked: 2014-04-17

Answer

According to the expression profile of fetal brain muscle, MEF2C is highly expressed in fetal brain muscle. So, it is likely that anti-MEF2C antibody A01131-1 will work for IHC with fetal brain muscle.

Boster Scientific Support

Answered: 2014-04-17

Question

Is this A01131-1 anti-MEF2C antibody reactive to the isotypes of MEF2C?

J. Jha

Verified customer

Asked: 2013-09-16

Answer

The immunogen of A01131-1 anti-MEF2C antibody is A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-09-16

Order DetailsPrice
A01131-1

100μg

$370
A01131-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A01131-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A01131-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A01131-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A01131-1-APC

100 μg APC conjugated (liquid)

$820
A01131-1-FITC

100 μg FITC conjugated (liquid)

$570
A01131-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A01131-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A01131-1-HRP

100 μg HRP conjugated (liquid)

$570
A01131-1-PE

100 μg PE conjugated (liquid)

$820
A01131-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01131-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Apr 14, 2026