APE1 (APEX1) (NM_080649) Human Recombinant Protein

APE protein,

Product Info Summary

SKU: PROTP27695
Size: 20 µg
Source: HEK293T

Product Name

APE1 (APEX1) (NM_080649) Human Recombinant Protein

View all APE recombinant proteins

SKU/Catalog Number

PROTP27695

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human APEX nuclease (multifunctional DNA repair enzyme) 1 (APEX1), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

APE1 (APEX1) (NM_080649) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP27695)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.555kDa

Amino Acid Sequence

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For APEX1 (Source: Uniprot.org, NCBI)

Gene Name

APEX1

Full Name

DNA-(apurinic or apyrimidinic site) lyase

Weight

35.555kDa

Superfamily

DNA repair enzymes AP/ExoA family

Alternative Names

AP endonuclease 1; APE; APE1; APE-1; APEAPEX nuclease (multifunctional DNA repair enzyme); APENAP endonuclease class I; APEX deoxyribonuclease (apurinic or apyrimidinic); APEX nuclease (multifunctional DNA repair enzyme) 1; APEX nuclease; APEX1; Apurinic-apyrimidinic endonuclease 1; APXAP lyase; DNA-(apurinic or apyrimidinic site) lyase; EC 3.1; EC 4.2.99.18; HAP1apurinic/apyrimidinic (abasic) endonuclease; multifunctional DNA repair enzyme; protein REF-1; redox factor 1; Redox factor-1; REF1 apurinic/apyrimidinic exonuclease; REF-1 APEX1 APE, APE1, APEN, APEX, APX, HAP1, REF1 apurinic/apyrimidinic endodeoxyribonuclease 1 DNA-(apurinic or apyrimidinic site) endonuclease|AP endonuclease class I|AP lyase|APEX nuclease (multifunctional DNA repair enzyme) 1|DNA-(apurinic or apyrimidinic site) lyase|apurinic-apyrimidinic endonuclease 1|apurinic/apyrimidinic (abasic) endonuclease|deoxyribonuclease (apurinic or apyrimidinic)|protein REF-1|redox factor-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on APEX1, check out the APEX1 Infographic

APEX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for APEX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP27695

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used APE1 (APEX1) (NM_080649) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review APE1 (APEX1) (NM_080649) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for APE1 (APEX1) (NM_080649) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP27695
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.