ARFRP1 (NM_003224) Human Recombinant Protein

ARFRP1 protein,

Recombinant protein of human ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 1

Product Info Summary

SKU: PROTQ13795
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ARFRP1 (NM_003224) Human Recombinant Protein

View all ARFRP1 recombinant proteins

SKU/Catalog Number

PROTQ13795

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ADP-ribosylation factor related protein 1 (ARFRP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ARFRP1 (NM_003224) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13795)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.614kDa

Amino Acid Sequence

MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT

Validation Images & Assay Conditions

Gene/Protein Information For ARFRP1 (Source: Uniprot.org, NCBI)

Gene Name

ARFRP1

Full Name

ADP-ribosylation factor-related protein 1

Weight

22.614kDa

Superfamily

small GTPase superfamily

Alternative Names

ADP-ribosylation factor related protein 1; ARF-related protein 1; ARL18; Arp1; ARPADP-ribosylation factor-related protein 1; helicase-like protein NHL; SCG10 like-protein ARFRP1 ARL18, ARP, Arp1 ADP ribosylation factor related protein 1 ADP-ribosylation factor-related protein 1|ARF-related protein 1|SCG10 like-protein|epididymis secretory sperm binding protein|helicase-like protein NHL

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ARFRP1, check out the ARFRP1 Infographic

ARFRP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ARFRP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13795

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ARFRP1 (NM_003224) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ARFRP1 (NM_003224) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ARFRP1 (NM_003224) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13795
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.