ARL4C (NM_005737) Human Recombinant Protein

ARL4C protein,

Recombinant protein of human ADP-ribosylation factor-like 4C (ARL4C)

Product Info Summary

SKU: PROTP56559
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ARL4C (NM_005737) Human Recombinant Protein

View all ARL4C recombinant proteins

SKU/Catalog Number

PROTP56559

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ADP-ribosylation factor-like 4C (ARL4C)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ARL4C (NM_005737) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP56559)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.487kDa

Amino Acid Sequence

MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR

Validation Images & Assay Conditions

Gene/Protein Information For ARL4C (Source: Uniprot.org, NCBI)

Gene Name

ARL4C

Full Name

ADP-ribosylation factor-like protein 4C

Weight

21.487kDa

Superfamily

small GTPase superfamily

Alternative Names

ADP ribosylation factor-like protein 7; ADP-ribosylation factor-like 4C; ADP-ribosylation factor-like 7; ADP-ribosylation factor-like protein 4C; ADP-ribosylation factor-like protein 7; ADP-ribosylation factor-like protein LAK; ARL7; LAK ARL4C ARL7, LAK ADP ribosylation factor like GTPase 4C ADP-ribosylation factor-like protein 4C|ADP ribosylation factor-like protein 7|ADP-ribosylation factor-like 4C|ADP-ribosylation factor-like 7|ADP-ribosylation factor-like protein LAK

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ARL4C, check out the ARL4C Infographic

ARL4C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ARL4C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP56559

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ARL4C (NM_005737) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ARL4C (NM_005737) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ARL4C (NM_005737) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP56559
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.