Biliverdin Reductase (BLVRA) (NM_000712) Human Recombinant Protein

Biliverdin Reductase A/BLVRA protein,

Product Info Summary

SKU: PROTP53004
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Biliverdin Reductase (BLVRA) (NM_000712) Human Recombinant Protein

View all Biliverdin Reductase A/BLVRA recombinant proteins

SKU/Catalog Number

PROTP53004

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human biliverdin reductase A (BLVRA)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Biliverdin Reductase (BLVRA) (NM_000712) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP53004)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.2 kDa

Amino Acid Sequence

MNTEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVSHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK

Validation Images & Assay Conditions

Gene/Protein Information For BLVRA (Source: Uniprot.org, NCBI)

Gene Name

BLVRA

Full Name

Biliverdin reductase A

Weight

33.2 kDa

Superfamily

Gfo/Idh/MocA family

Alternative Names

Biliverdin Reductase A; Biliverdin-IX alpha-reductase; BLVR; BLVRA; BVR A; BVR; BVRA; EC 1.3.1.24 BLVRA BLVR, BVR, BVRA biliverdin reductase A biliverdin reductase A|BVR A|biliverdin-IX alpha-reductase|testis tissue sperm-binding protein Li 61n

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BLVRA, check out the BLVRA Infographic

BLVRA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BLVRA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP53004

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Biliverdin Reductase (BLVRA) (NM_000712) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Biliverdin Reductase (BLVRA) (NM_000712) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Biliverdin Reductase (BLVRA) (NM_000712) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP53004
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.