C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein

Tyw5 protein,

Product Info Summary

SKU: PROTA2RUC4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein

View all Tyw5 recombinant proteins

SKU/Catalog Number

PROTA2RUC4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 2 open reading frame 60 (C2orf60), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA2RUC4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.633kDa

Amino Acid Sequence

MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE

Validation Images & Assay Conditions

Gene/Protein Information For Tyw5 (Source: Uniprot.org, NCBI)

Gene Name

Tyw5

Full Name

tRNA wybutosine-synthesizing protein 5

Weight

36.633kDa

Superfamily

TYW5 family

Alternative Names

tRNA-yW synthesizing protein 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Tyw5, check out the Tyw5 Infographic

Tyw5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Tyw5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA2RUC4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C2orf60 (TYW5) (NM_001039693) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA2RUC4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.