Product Info Summary
| SKU: | DZ01481 |
|---|---|
| Size: | 200 μl/vial |
| Reactive Species: | Zebrafish |
| Host: | Rabbit |
| Application: | IF |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Zebrafish Ush2a Antibody
SKU/Catalog Number
DZ01481
Size
200 μl/vial
Form
Liquid
Description
Boster Bio Polyclonal Anti-Ush2a Antibody catalog # DZ01481. This antibody reacts with Zebrafish.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Zebrafish Ush2a Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # DZ01481)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Isotype
Rabbit IgG
Reactive Species
DZ01481 is reactive to ush2a in Zebrafish
Application & Images
Applications
DZ01481 is guaranteed for IF Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Immunofluorescence | 1:200 |
Validation Images & Assay Conditions
Click image to see more details
IF analysis of Ush2a using anti-Ush2a antibody (DZ01481).
Ush2a was detected in cryosections of wildtype zebrafish retina tissue without prior fixation. The tissue section was blocked with Blocking buffer (10% NGS, 2% BSA, 0.1% Tween in PBS) for 30 minutes. The tissue section was then incubated with rabbit anti-Ush2a Antibody (DZ01481) in blocking solution at 1:200 dilution overnight at 4°C. Alexa Fluor® 568 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody a and incubated for 1 hour at room temperature in blocking solution. Post immuno-fixation with 4% PFA in PBS for 10 minutes. Mount in Prolong gold.
Click image to see more details
Analysis of usherin and Whrnb expression in retinal sections of wild-type, adgrv1rmc22, and adgrv1Δexon40-42 zebrafish.
Retinal cryosections of wild-type, mutant adgrv1rmc22, and adgrv1Δexon40-42 zebrafish larvae (5 dpf) labeled with antibodies directed against Whrnb (red) (A) or usherin (red) (B) and centrin (green). Nuclei are counterstained with DAPI (blue). (A) Both in wild-type and in adgrv1Δexon40-42 zebrafish larvae, Whrnb was present at the photoreceptor periciliary region in close proximity to centrin. Quantification revealed that the Whrnb signal intensity in adgrv1Δexon40-42 retinal sections is similar to that in wild-type sections, whereas a significant reduction of Whrnb signal was observed in retinae of adgrv1rmc22 larvae. Magnified images are shown at the right side. Bar graphs represent the mean fluorescence intensity of anti-Whrnb staining of all photoreceptors of a single, central section of one larval zebrafish eye (n = 14 eyes). (B) Both in wild-type and adgrv1Δexon40-42 zebrafish larvae, usherin was present at the photoreceptor periciliary region in close proximity to centrin. Quantification reveals that the usherin signal intensity in retinal sections of adgrv1Δexon40-42 larvae is similar to that in sections of wild types, whereas a significant reduction of usherin signal was observed in retinae of adgrv1rmc22 larvae. Bar graphs represent the mean fluorescence intensity of anti-usherin staining of all photoreceptors of a single, central section of one larval zebrafish eye, with mean ± SD (n = 14 eyes). Data were analyzed using one-way ANOVA followed by Tukey’s multiple comparison test (∗∗p < 0.01; ∗∗∗∗p < 0.0001). Scale bars, 10 μm.
Index in PubMed under a CC BY license. PMID: 41036464
Specific Publications For Anti-Zebrafish Ush2a Antibody (DZ01481)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Zebrafish Ush2a Antibody?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
1 Reviews For Anti-Zebrafish Ush2a Antibody
Thank you for all the work on this project
Excellent

| SKU | DZ01481 |
|---|---|
| Application | Immunofluorescence |
| Sample | wildtype and KO mutant zebrafish retina |
| Primary Incubation | 1:200 |
| Blocking Agent | 10% normal goat serum and 2% bovine serum albumin in PBS |
| Secondary Antibody | Alexa Fluor 568 goat anti-rabbit was used in blocking solution. |
Erik de Vrieze
Verified customer
Submitted 2025-10-09
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
1 Customer Q&As for Anti-Zebrafish Ush2a Antibody
Question
Can you send me the immunology of this antibody?
Verified customer
Asked: 2022-09-30
Answer
The immunogen sequence for DZ01481 is listed below. MGLVLKRALSKPPFIRERPPIMPLQRRSTKYPPKDSYLFDNIADSSCSITLKRFAMRTEGLTDTKIGGTCTSNHSYQASMSVLRVPSQSQLSHAYSQNSLHRSVSQLIDTQDKKSWDADLHATDSGMYVGDEDFGETIKSYSSVKKEQTMFTDTHL
Boster Scientific Support
Answered: 2022-09-30


